Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens thymosin beta 15a (TMSB15A) (NM_021992). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P0CG34 |
| Entry Name | TB15A_HUMAN |
| Gene Names | TMSB15A TMSL8 TMSNB |
| Alternative Gene Names | TMSL8 TMSNB |
| Alternative Protein Names | Thymosin beta-15A (NB thymosin beta) (Thymosin-like protein 8) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 45 |
| Molecular Weight(Da) | 5229 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS |
Background
| Function | FUNCTION: Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity). {ECO:0000250}. |
| Pathway | |
| Protein Families | Thymosin beta family |
| Tissue Specificity | Neuroblastoma-specific. {ECO:0000269|PubMed:9039501}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |