Recombinant Human TMEM35A protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens transmembrane protein 35A (TMEM35AA) (NM_021637).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q53FP2
Entry Name NACHO_HUMAN
Gene Names TMEM35A NACHO TMEM35
Alternative Gene Names NACHO TMEM35
Alternative Protein Names Novel acetylcholine receptor chaperone
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 167
Molecular Weight(Da) 18440
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS
Background
Function FUNCTION: Molecular chaperone which mediates the proper assembly and functional expression of the nicotinic acetylcholine receptors (nAChRs) throughout the brain (PubMed:26875622, PubMed:27789755, PubMed:28445721, PubMed:32204458, PubMed:32783947). Essential for the proper folding, assembly, function and surface trafficking of alpha-7 (CHRNA7), alpha-4-beta-2, alpha-3-beta-2 and alpha-3-beta-4 receptors (PubMed:26875622, PubMed:27789755, PubMed:28445721, PubMed:32204458, PubMed:32783947). Stably associates with ribophorin-1 (RPN1) and ribophorin-2 (RPN2) (components of the oligosaccharyl transferase (OST) complex) and with calnexin (CANX), both of which are critical for NACHO-mediated effects on CHRNA7 assembly and function (By similarity). Facilitates the proper folding and assembly of alpha-6-beta-2 and alpha-6-beta-2-beta-3 receptors and acts at early stages of the nAChRs subunit assembly (PubMed:28445721). Promotes the expression of the alpha-4(2):beta-2(3) stoichiometric form over the alpha-4(3):beta-2(2) form (PubMed:32676916). {ECO:0000250|UniProtKB:Q9D328, ECO:0000269|PubMed:26875622, ECO:0000269|PubMed:27789755, ECO:0000269|PubMed:28445721, ECO:0000269|PubMed:32204458, ECO:0000269|PubMed:32676916, ECO:0000269|PubMed:32783947}.
Pathway
Protein Families DoxX family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8036115

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TMEM35A protein
Copyright © 2021-present Echo Biosystems. All rights reserved.