Recombinant Human TLC domain-containing protein 1(TLCD1)

Specification
Organism Homo sapiens (Human)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q96CP7
Gene Names TLCD1
Alternative Names TLC domain-containing protein 1(Calfacilitin)
Expression Region Full Length of Mature Protein(36-247aa )
Molecular Weight 26.1 kDa
Protein Sequence RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Regulates the composition and fluidity of the plasma membrane (PubMed:30509349). Inhibits the incorporation of membrane-fluidizing phospholipids containing omega-3 long-chain polyunsaturated fatty acids (LCPUFA) and thereby promotes membrane rigidity (PubMed:30509349). Does not appear to have any effect on LCPUFA synthesis (PubMed:30509349).
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity TLCD1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,714.00
In stock
SKU
EB-PC1HU822316

Recombinant Human TLC domain-containing protein 1(TLCD1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TLC domain-containing protein 1(TLCD1)
Copyright © 2021-present Echo Biosystems. All rights reserved.