Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Protein Tag | C-terminal 10xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Measured by its binding ability in a functional ELISA. Please contact us for the specific data. |
| Uniprot ID | P10646 |
| Gene Names | TFPI |
| Alternative Names | (TFPI)(Extrinsic pathway inhibitor)(EPI)(Lipoprotein-associated coagulation inhibitor)(LACI) |
| Expression Region | 29-282aa |
| Product Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.9 |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-370℃. |
| Protein Length | Partial |
| Molecular Weight | 31.9 kDa |
| Protein Sequence | DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK |
Background
| Research Areas | Cardiovascular |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |