Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens translocase of inner mitochondrial membrane 9 (TIMM9), transcript variant 1 (NM_012460). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y5J7 |
| Entry Name | TIM9_HUMAN |
| Gene Names | TIMM9 TIM9 TIM9A TIMM9A |
| Alternative Gene Names | TIM9 TIM9A TIMM9A |
| Alternative Protein Names | Mitochondrial import inner membrane translocase subunit Tim9 |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 89 |
| Molecular Weight(Da) | 10378 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR |
Background
| Function | FUNCTION: Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. {ECO:0000269|PubMed:14726512}. |
| Pathway | |
| Protein Families | Small Tim family |
| Tissue Specificity | Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. {ECO:0000269|PubMed:10552927, ECO:0000269|PubMed:10611480}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |