Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P07202 |
| Gene Names | TPO |
| Alternative Names | MSA ; PERT_HUMAN; TDH2A; Thyroid microsomal antigen; Thyroid peroxidase; Thyroperoxidase; TPO; TPX |
| Expression Region | Partial(19-161aa ) |
| Molecular Weight | 17.9 kDa |
| Protein Sequence | FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T3 and T4. |
| Involvement in Disease | Thyroid dyshormonogenesis 2A (TDH2A) |
| Subcellular Location | Membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell surface |
| Protein Families | Peroxidase family, XPO subfamily |
| Tissue Specificity | TPO |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |