Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P40225 |
| Gene Names | THPO |
| Alternative Names | C-mpl ligand Short name: ML Megakaryocyte colony-stimulating factor Megakaryocyte growth and development factor Short name: MGDF Myeloproliferative leukemia virus oncogene ligand |
| Expression Region | Partial(22-195aa ) |
| Molecular Weight | 34.7 kDa |
| Protein Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. |
| Involvement in Disease | Thrombocythemia 1 (THCYT1) |
| Subcellular Location | Secreted |
| Protein Families | EPO/TPO family |
| Tissue Specificity | THPO |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |