Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P41732 |
| Gene Names | TSPAN7 |
| Alternative Names | Cell surface glycoprotein A15Membrane component chromosome X surface marker 1T-cell acute lymphoblastic leukemia-associated antigen 1 ;TALLA-1Transmembrane 4 superfamily member 2;; CD231 |
| Expression Region | Extracellular Domain(113-223aa ) |
| Molecular Weight | 14.5 kDa |
| Protein Sequence | RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be involved in cell proliferation and cell motility. |
| Involvement in Disease | Mental retardation, X-linked 58 (MRX58) |
| Subcellular Location | Membrane, Multi-pass membrane protein |
| Protein Families | Tetraspanin (TM4SF) family |
| Tissue Specificity | TSPAN7 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
