Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O14746 |
| Gene Names | TERT |
| Alternative Names | HEST2 Telomerase catalytic subunit Telomerase-associated protein 2 |
| Expression Region | Partial(281-436aa ) |
| Molecular Weight | 22.7 kDa |
| Protein Sequence | EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'-TTAGGG-3'. The catalytic cycle involves primer binding, primer extension and release of product once the template boundary has been reached or nascent product translocation followed by further extension. More active on substrates containing 2 or 3 telomeric repeats. Telomerase activity is regulated by a number of factors including telomerase complex-associated proteins, chaperones and polypeptide modifiers. Modulates Wnt signaling. Plays important roles in aging and antiapoptosis. |
| Involvement in Disease | Aplastic anemia (AA); Dyskeratosis congenita, autosomal dominant, 2 (DKCA2); Pulmonary fibrosis, and/or bone marrow failure, telomere-related, 1 (PFBMFT1); Dyskeratosis congenita, autosomal recessive, 4 (DKCB4); Pulmonary fibrosis, idiopathic (IPF); Melanoma, cutaneous malignant 9 (CMM9) |
| Subcellular Location | Nucleus, nucleolus, Nucleus, nucleoplasm, Nucleus, Chromosome, telomere, Cytoplasm, Nucleus, PML body |
| Protein Families | Reverse transcriptase family, Telomerase subfamily |
| Tissue Specificity | TERT |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |