Recombinant Human TCTA protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens T cell leukemia translocation altered (TCTA) (NM_022171).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P57738
Entry Name TCTA_HUMAN
Gene Names TCTA
Alternative Gene Names
Alternative Protein Names T-cell leukemia translocation-altered gene protein (T-cell leukemia translocation-associated gene protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 103
Molecular Weight(Da) 11341
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE
Background
Function FUNCTION: May be required for cellular fusion during osteoclastogenesis. {ECO:0000269|PubMed:19560569}.
Pathway
Protein Families TCTA family
Tissue Specificity Ubiquitous. Highest level of expression in kidney. Present in monocytes, osteoclasts, macrophages, synoviocytes and synovial lining cells (at protein level). {ECO:0000269|PubMed:7728759}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8414945

Recombinant Human TCTA protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TCTA protein
Copyright © 2021-present Echo Biosystems. All rights reserved.