Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens T cell leukemia translocation altered (TCTA) (NM_022171). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P57738 |
| Entry Name | TCTA_HUMAN |
| Gene Names | TCTA |
| Alternative Gene Names | |
| Alternative Protein Names | T-cell leukemia translocation-altered gene protein (T-cell leukemia translocation-associated gene protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 103 |
| Molecular Weight(Da) | 11341 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE |
Background
| Function | FUNCTION: May be required for cellular fusion during osteoclastogenesis. {ECO:0000269|PubMed:19560569}. |
| Pathway | |
| Protein Families | TCTA family |
| Tissue Specificity | Ubiquitous. Highest level of expression in kidney. Present in monocytes, osteoclasts, macrophages, synoviocytes and synovial lining cells (at protein level). {ECO:0000269|PubMed:7728759}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |