Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens T cell leukemia/lymphoma 1B (TCL1B) (NM_004918). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O95988 |
| Entry Name | TCL1B_HUMAN |
| Gene Names | TCL1B TCL1 |
| Alternative Gene Names | TCL1 |
| Alternative Protein Names | T-cell leukemia/lymphoma protein 1B (Oncogene TCL-1B) (Oncogene TCL1B) (SYN-1) (Syncytiotrophoblast-specific protein) (TCL1/MTCP1-like protein 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 128 |
| Molecular Weight(Da) | 14846 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKD |
Background
| Function | FUNCTION: Enhances the phosphorylation and activation of AKT1 and AKT2. {ECO:0000269|PubMed:10983986}. |
| Pathway | |
| Protein Families | TCL1 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |