Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O14907 |
| Gene Names | TAX1BP3 |
| Alternative Names | Glutaminase-interacting protein 3Tax interaction protein 1 ;TIP-1Tax-interacting protein 1 |
| Expression Region | Full Length(1-124aa ) |
| Molecular Weight | 40.7 kDa |
| Protein Sequence | MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Nucleus, Cell membrane, Peripheral membrane protein, Cytoplasmic side |
| Protein Families | |
| Tissue Specificity | TAX1BP3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
