Specification
    
        | Organism | Homo sapiens (Human) | 
| Expression Host | Yeast | 
| Tag Info | N-terminal 6xHis-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | Q9Y4G6 | 
| Gene Names | TLN2 | 
| Alternative Names | DKFZp451B1011; DKFZp686I0976; DKFZp686K0979; ILWEQ; KIAA0320; Talin-2; talin2; TLN 2; TLN2; TLN2_HUMAN | 
| Expression Region | Partial(88-406aa ) | 
| Molecular Weight | 39.1 kDa | 
| Protein Sequence | RPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKK | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity . | 
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Cell junction, focal adhesion, Cell junction, synapse, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton | 
| Protein Families | |
| Tissue Specificity | TLN2 | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) |  | 
 
