Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens TATA-box binding protein associated factor 13 (TAF13) (NM_005645). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q15543 |
| Entry Name | TAF13_HUMAN |
| Gene Names | TAF13 TAF2K TAFII18 |
| Alternative Gene Names | TAF2K TAFII18 |
| Alternative Protein Names | Transcription initiation factor TFIID subunit 13 (Transcription initiation factor TFIID 18 kDa subunit) (TAF(II)18) (TAFII-18) (TAFII18) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 124 |
| Molecular Weight(Da) | 14287 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS |
Background
| Function | FUNCTION: Component of the DNA-binding general RNA polymerase II transcription factor IID complex (TFIID). TFIID plays a critical role in the regulation of gene transcription in eukaryotic cells. {ECO:0000269|PubMed:9695952}. |
| Pathway | |
| Protein Families | TAF13 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |