Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens TATA-box binding protein associated factor 12 (TAF12), transcript variant 2 (NM_005644). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q16514 |
| Entry Name | TAF12_HUMAN |
| Gene Names | TAF12 TAF15 TAF2J TAFII20 |
| Alternative Gene Names | TAF15 TAF2J TAFII20 |
| Alternative Protein Names | Transcription initiation factor TFIID subunit 12 (Transcription initiation factor TFIID 20/15 kDa subunits) (TAFII-20/TAFII-15) (TAFII20/TAFII15) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 161 |
| Molecular Weight(Da) | 17924 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK |
Background
| Function | FUNCTION: TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription. |
| Pathway | |
| Protein Families | TAF12 family |
| Tissue Specificity | Ubiquitous. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
