Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P01732 |
| Gene Names | CD8A |
| Alternative Names | T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a |
| Expression Region | Extracellular Domain(22-182aa ) |
| Molecular Weight | 21.6 kDa |
| Protein Sequence | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains. |
| Involvement in Disease | CD8 deficiency, familial (CD8 deficiency) |
| Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein |
| Protein Families | |
| Tissue Specificity | CD8A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
