Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P07766 |
| Gene Names | CD3E |
| Alternative Names | T-cell surface antigen T3/Leu-4 epsilon chain; CD3e |
| Expression Region | Full Length of Mature Protein(23-207aa ) |
| Molecular Weight | 47.7 kDa |
| Protein Sequence | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The CD3 complex mediates signal transduction. |
| Involvement in Disease | Immunodeficiency 18 (IMD18) |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | |
| Tissue Specificity | CD3E |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |