Recombinant Human SYS1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens SYS1 golgi trafficking protein (SYS1), transcript variant 1 (NM_033542).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8N2H4
Entry Name SYS1_HUMAN
Gene Names SYS1 C20orf169
Alternative Gene Names C20orf169
Alternative Protein Names Protein SYS1 homolog
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 156
Molecular Weight(Da) 17615
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV
Background
Function FUNCTION: Involved in protein trafficking. May serve as a receptor for ARFRP1.
Pathway
Protein Families SYS1 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8484326

Recombinant Human SYS1 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SYS1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.