Recombinant Human Synaptogyrin-1(SYNGR1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O43759
Gene Names SYNGR1
Alternative Names /
Expression Region Full Length of Isoform 1B(1-191aa )
Molecular Weight 48 kDa
Protein Sequence MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the regulation of short-term and long-term synaptic plasticity.
Involvement in Disease
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Multi-pass membrane protein, Melanosome
Protein Families Synaptogyrin family
Tissue Specificity SYNGR1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PEF2230237

Recombinant Human Synaptogyrin-1(SYNGR1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Synaptogyrin-1(SYNGR1)
Copyright © 2026-present Echo Bio. All rights reserved.