Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens small vasohibin binding protein (SVBP) (NM_199342). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8N300 |
| Entry Name | SVBP_HUMAN |
| Gene Names | SVBP CCDC23 |
| Alternative Gene Names | CCDC23 |
| Alternative Protein Names | Small vasohibin-binding protein (Coiled coil domain-containing protein 23) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 66 |
| Molecular Weight(Da) | 7808 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE |
Background
| Function | FUNCTION: Enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin (PubMed:29146869, PubMed:31270470, PubMed:31235911, PubMed:31324789, PubMed:31171830, PubMed:31235910). This activity is critical for spindle function and accurate chromosome segregation during mitosis since microtuble detyronisation regulates mitotic spindle length and postioning (PubMed:31171830). Also required to enhance the solubility and secretion of VASH1 and VASH2 (PubMed:20736312, PubMed:27879017, PubMed:30607023). Plays a role in axon and excitatory synapse formation (PubMed:31235911). {ECO:0000269|PubMed:20736312, ECO:0000269|PubMed:27879017, ECO:0000269|PubMed:29146869, ECO:0000269|PubMed:30607023, ECO:0000269|PubMed:31171830, ECO:0000269|PubMed:31235910, ECO:0000269|PubMed:31235911, ECO:0000269|PubMed:31270470, ECO:0000269|PubMed:31324789}. |
| Pathway | |
| Protein Families | SVBP family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |