Specification
Description | Recombinant protein from the full-length sequence of homo sapiens small ubiquitin-like modifier 4 (SUMO4) (NM_001002255). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | Q6EEV6 |
Entry Name | SUMO4_HUMAN |
Gene Names | SUMO4 SMT3H4 |
Alternative Gene Names | SMT3H4 |
Alternative Protein Names | Small ubiquitin-related modifier 4 (SUMO-4) (Small ubiquitin-like protein 4) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 95 |
Molecular Weight(Da) | 10685 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY |
Background
Function | FUNCTION: Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjugate to NFKBIA, TFAP2A and FOS, negatively regulating their transcriptional activity, and to NR3C1, positively regulating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I. {ECO:0000269|PubMed:15123604, ECO:0000269|PubMed:15247916, ECO:0000269|PubMed:16236267}. |
Pathway | |
Protein Families | Ubiquitin family, SUMO subfamily |
Tissue Specificity | Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen. {ECO:0000269|PubMed:15123604, ECO:0000269|PubMed:15247916}. |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |