Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens small ubiquitin like modifier 3 (SUMO3), transcript variant 1 (NM_006936). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P55854 |
| Entry Name | SUMO3_HUMAN |
| Gene Names | SUMO3 SMT3A SMT3H1 |
| Alternative Gene Names | SMT3A SMT3H1 |
| Alternative Protein Names | Small ubiquitin-related modifier 3 (SUMO-3) (SMT3 homolog 1) (SUMO-2) (Ubiquitin-like protein SMT3A) (Smt3A) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 103 |
| Molecular Weight(Da) | 11637 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF |
Background
| Function | FUNCTION: Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4 (PubMed:11451954, PubMed:18538659, PubMed:21965678). Plays a role in the regulation of sumoylation status of SETX (PubMed:24105744). {ECO:0000269|PubMed:11451954, ECO:0000269|PubMed:18538659, ECO:0000269|PubMed:21965678}. |
| Pathway | |
| Protein Families | Ubiquitin family, SUMO subfamily |
| Tissue Specificity | Expressed predominantly in liver. {ECO:0000269|PubMed:15487983}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |