Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q96I99 |
| Gene Names | SUCLG2 |
| Alternative Names | GTP-specific succinyl-CoA synthetase subunit beta;Succinyl-CoA synthetase beta-G chain ;SCS-betaG |
| Expression Region | Partial(49-423aa ) |
| Molecular Weight | 56.3 kDa |
| Protein Sequence | MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes the GTP-dependent ligation of succinate and CoA to form succinyl-CoA. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion |
| Protein Families | Succinate/malate CoA ligase beta subunit family, GTP-specific subunit beta subfamily |
| Tissue Specificity | SUCLG2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |