Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P31040 |
| Gene Names | SDHA |
| Alternative Names | Flavoprotein subunit of complex II ;Fp |
| Expression Region | Partial(44-293aa ) |
| Molecular Weight | 54.1 kDa |
| Protein Sequence | SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor. |
| Involvement in Disease | Mitochondrial complex II deficiency (MT-C2D); Leigh syndrome (LS); Cardiomyopathy, dilated 1GG (CMD1GG); Paragangliomas 5 (PGL5) |
| Subcellular Location | Mitochondrion inner membrane, Peripheral membrane protein, Matrix side |
| Protein Families | FAD-dependent oxidoreductase 2 family, FRD/SDH subfamily |
| Tissue Specificity | SDHA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |