Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q15772 |
| Gene Names | SPEG |
| Alternative Names | Aortic preferentially expressed protein 1 ;APEG-1 |
| Expression Region | Partial(1-113aa ) |
| Molecular Weight | 38.7 kDa |
| Protein Sequence | MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells. |
| Involvement in Disease | Myopathy, centronuclear, 5 (CNM5) |
| Subcellular Location | Isoform 3: Nucleus |
| Protein Families | Protein kinase superfamily, CAMK Ser/Thr protein kinase family |
| Tissue Specificity | SPEG |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |