Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens small proline rich protein 2B (SPRR2B) (NM_001017418). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P35325 |
| Entry Name | SPR2B_HUMAN |
| Gene Names | SPRR2B |
| Alternative Gene Names | |
| Alternative Protein Names | Small proline-rich protein 2B (SPR-2B) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 72 |
| Molecular Weight(Da) | 7975 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK |
Background
| Function | FUNCTION: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. |
| Pathway | |
| Protein Families | Cornifin (SPRR) family |
| Tissue Specificity | Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |