Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q15506 |
| Gene Names | SPA17 |
| Alternative Names | Cancer/testis antigen 22 ;CT22Sp17-1Sperm autoantigenic protein 17 ;Sperm protein 17 |
| Expression Region | Partial(1-146aa ) |
| Molecular Weight | 43.8 kDa |
| Protein Sequence | MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates . |
| Involvement in Disease | |
| Subcellular Location | Membrane, Peripheral membrane protein |
| Protein Families | |
| Tissue Specificity | SPA17 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |