Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P49901 |
| Gene Names | SMCP |
| Alternative Names | HSMCSGEN1 ; MCS ; MCSP ; MCSP_HUMAN; Mitochondrial capsule selenoprotein; SMCP; Sperm mitochondria associated cysteine rich protein; Sperm mitochondrial-associated cysteine-rich protein |
| Expression Region | Full Length(1-116aa ) |
| Molecular Weight | 39.8 kDa |
| Protein Sequence | MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the fale reproductive tract and inability to penetrate the oocyte zona pellucida . |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Mitochondrion membrane, Peripheral membrane protein, Cytoplasmic side |
| Protein Families | |
| Tissue Specificity | SMCP |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
