Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8N0X2 |
| Gene Names | SPAG16 |
| Alternative Names | Pf20 protein homolog |
| Expression Region | Full Length of Isoform 4(1-183aa ) |
| Molecular Weight | 47.6 kDa |
| Protein Sequence | MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Cytoplasm, cytoskeleton, flagellum axoneme, Cytoplasm, cytoskeleton, cilium axoneme |
| Protein Families | |
| Tissue Specificity | SPAG16 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |