Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1) (NM_013453). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NS26 |
| Entry Name | SPNXA_HUMAN |
| Gene Names | SPANXA1 SPANXA; SPANXA2 |
| Alternative Gene Names | SPANXA; |
| Alternative Protein Names | Sperm protein associated with the nucleus on the X chromosome A (Cancer/testis antigen 11.1) (CT11.1) (Nuclear-associated protein SPAN-Xa) (SPAN-X) (SPANX-A) (SPANX family member A) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 97 |
| Molecular Weight(Da) | 11038 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK |
Background
| Function | |
| Pathway | |
| Protein Families | SPAN-X family |
| Tissue Specificity | Detected in testis and sperm. {ECO:0000269|PubMed:10906052, ECO:0000269|PubMed:12758128}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |