Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens sperm acrosome associated 4 (SPACA4) (NM_133498). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8TDM5 |
| Entry Name | SACA4_HUMAN |
| Gene Names | SPACA4 SAMP14 UNQ3046/PRO9862 |
| Alternative Gene Names | SAMP14 |
| Alternative Protein Names | Sperm acrosome membrane-associated protein 4 (Sperm acrosomal membrane-associated protein 14) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 124 |
| Molecular Weight(Da) | 13004 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLPPRLL |
Background
| Function | FUNCTION: Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. {ECO:0000269|PubMed:12788941}. |
| Pathway | |
| Protein Families | SPACA4/bouncer family |
| Tissue Specificity | Testis specific (PubMed:12788941). Expressed in spermatozoa (PubMed:12788941). {ECO:0000269|PubMed:12788941}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |