Recombinant Human Sorting nexin-24(SNX24)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9Y343
Gene Names SNX24
Alternative Names PRO1284; SBBI31; SNX24; SNX24_HUMAN; Sorting nexin 24; Sorting nexin-24; Sorting nexing 24; UNQ654
Expression Region Full Length(1-169aa )
Molecular Weight 35.8 kDa
Protein Sequence MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May be involved in several stages of intracellular trafficking.
Involvement in Disease
Subcellular Location Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families Sorting nexin family
Tissue Specificity SNX24
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE9HU22494

Recombinant Human Sorting nexin-24(SNX24)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Sorting nexin-24(SNX24)
Copyright © 2021-present Echo Biosystems. All rights reserved.