Recombinant Human Sorting nexin-20(SNX20),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q7Z614
Gene Names SNX20
Alternative Names Selectin ligand-interactor Cytoplasmic domain 1
Expression Region Partial(1-102aa )
Molecular Weight 38.4 kDa
Protein Sequence MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Serves as a sorting protein that cycles P-selectin glycoprotein ligand 1 (PSLG1) into endosomes with no impact on leukocytes recruitment.
Involvement in Disease
Subcellular Location Early endosome membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Cytoplasm, Nucleus
Protein Families Sorting nexin family
Tissue Specificity SNX20
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE6HU22491

Recombinant Human Sorting nexin-20(SNX20),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Sorting nexin-20(SNX20),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.