Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P54710 |
| Gene Names | FXYD2 |
| Alternative Names | FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain |
| Expression Region | Full Length of Isoform 2(1-64aa ) |
| Molecular Weight | 34.4 kDa |
| Protein Sequence | MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase. |
| Involvement in Disease | Hypomagnesemia 2 (HOMG2) |
| Subcellular Location | Membrane, Single-pass type III membrane protein |
| Protein Families | FXYD family |
| Tissue Specificity | FXYD2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |