Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P31639 |
Gene Names | SLC5A2 |
Alternative Names | Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2 |
Expression Region | Partial(1-102aa ) |
Molecular Weight | 15.5 kDa |
Protein Sequence | MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules |
Involvement in Disease | Renal glucosuria (GLYS) |
Subcellular Location | Membrane, Multi-pass membrane protein |
Protein Families | Sodium:solute symporter (SSF) (TC 2.A.21) family |
Tissue Specificity | SLC5A2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |