Recombinant Human Sodium/glucose cotransporter 2(SLC5A2),partial

Specification
Organism Homo sapiens (Human)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P31639
Gene Names SLC5A2
Alternative Names Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2
Expression Region Partial(1-102aa )
Molecular Weight 30.5 kDa
Protein Sequence MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules.
Involvement in Disease Renal glucosuria (GLYS)
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Sodium:solute symporter (SSF) (TC 2.A.21) family
Tissue Specificity SLC5A2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$754.00
In stock
SKU
EB-PCHU1216916

Recombinant Human Sodium/glucose cotransporter 2(SLC5A2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Sodium/glucose cotransporter 2(SLC5A2),partial
Copyright © 2026-present Echo Bio. All rights reserved.