Specification
| Organism | Homo sapiens (Human) |
| Expression Host | in vitro E.coli expression system |
| Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P31639 |
| Gene Names | SLC5A2 |
| Alternative Names | Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2 |
| Expression Region | Partial(1-102aa ) |
| Molecular Weight | 30.5 kDa |
| Protein Sequence | MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules. |
| Involvement in Disease | Renal glucosuria (GLYS) |
| Subcellular Location | Membrane, Multi-pass membrane protein |
| Protein Families | Sodium:solute symporter (SSF) (TC 2.A.21) family |
| Tissue Specificity | SLC5A2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |