Specification
Organism | Homo sapiens (Human) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | O95436 |
Gene Names | SLC34A2 |
Alternative Names | Na(+)-dependent phosphate cotransporter 2BNaPi3bSodium/phosphate cotransporter 2B ;Na(+)/Pi cotransporter 2B ;NaPi-2bSolute carrier family 34 member 2 |
Expression Region | Cytoplasmic Domain(574-689aa ) |
Molecular Weight | 15.1 kDa |
Protein Sequence | LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border mbrane. May have a role in the synthesis of surfactant in lungs' alveoli. |
Involvement in Disease | Pulmonary alveolar microlithiasis (PALM) |
Subcellular Location | Membrane, Multi-pass membrane protein |
Protein Families | SLC34A transporter family |
Tissue Specificity | SLC34A2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |