Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-B2M-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O95436 |
| Gene Names | SLC34A2 |
| Alternative Names | Na(+)-dependent phosphate cotransporter 2B NaPi3b Sodium/phosphate cotransporter 2B |
| Expression Region | Partial(574-689aa ) |
| Molecular Weight | 27.1 kDa |
| Protein Sequence | LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. |
| Involvement in Disease | Pulmonary alveolar microlithiasis (PALM) |
| Subcellular Location | Membrane, Multi-pass membrane protein |
| Protein Families | SLC34A transporter family |
| Tissue Specificity | SLC34A2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |