Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens submaxillary gland androgen regulated protein 3B (SMR3B) (NM_006685). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P02814 |
| Entry Name | SMR3B_HUMAN |
| Gene Names | SMR3B PBII PRL3 PROL3 |
| Alternative Gene Names | PBII PRL3 PROL3 |
| Alternative Protein Names | Submaxillary gland androgen-regulated protein 3B (Proline-rich peptide P-B) (Proline-rich protein 3) [Cleaved into: Peptide P-A; Peptide D1A] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 79 |
| Molecular Weight(Da) | 8188 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP |
Background
| Function | |
| Pathway | |
| Protein Families | PROL1/PROL3 family |
| Tissue Specificity | Secreted into saliva by submaxillary gland. Not expressed in heart, brain, lung, liver, skeletal muscle, Kidney, pancreas or placenta. {ECO:0000269|PubMed:7982889}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |