Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens small cell adhesion glycoprotein (SMAGP), transcript variant 2 (NM_001033873). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q0VAQ4 |
| Entry Name | SMAGP_HUMAN |
| Gene Names | SMAGP |
| Alternative Gene Names | |
| Alternative Protein Names | Small cell adhesion glycoprotein (Small transmembrane and glycosylated protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 97 |
| Molecular Weight(Da) | 10679 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI |
Background
| Function | FUNCTION: May play a role in epithelial cell-cell contacts. May play a role in tumor invasiveness and metastasis formation. {ECO:0000269|PubMed:15986429}. |
| Pathway | |
| Protein Families | SMAGP family |
| Tissue Specificity | Detected in breast, endometrium, colon and biliary tract. Detected in polarized epithelial structures characterized by cell-cell adhesion (at protein level). {ECO:0000269|PubMed:15021913}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |