Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens small cell adhesion glycoprotein (SMAGP), transcript variant 2 (NM_001033873). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | Q0VAQ4 |
Entry Name | SMAGP_HUMAN |
Gene Names | SMAGP |
Alternative Gene Names | |
Alternative Protein Names | Small cell adhesion glycoprotein (Small transmembrane and glycosylated protein) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 97 |
Molecular Weight(Da) | 10679 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI |
Background
Function | FUNCTION: May play a role in epithelial cell-cell contacts. May play a role in tumor invasiveness and metastasis formation. {ECO:0000269|PubMed:15986429}. |
Pathway | |
Protein Families | SMAGP family |
Tissue Specificity | Detected in breast, endometrium, colon and biliary tract. Detected in polarized epithelial structures characterized by cell-cell adhesion (at protein level). {ECO:0000269|PubMed:15021913}. |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |