Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens Ly6/neurotoxin 1 (SLURP2), transcript variant SLURP2 (NM_177458). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P0DP57 |
| Entry Name | SLUR2_HUMAN |
| Gene Names | SLURP2 |
| Alternative Gene Names | |
| Alternative Protein Names | Secreted Ly-6/uPAR domain-containing protein 2 (Secreted LY6/PLAUR domain-containing protein 2) (Secreted Ly-6/uPAR-related protein 2) (SLURP-2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 97 |
| Molecular Weight(Da) | 10160 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD |
Background
| Function | FUNCTION: Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3:beta-2-containing nAChRs and strongly these of alpha-4:beta-2-containing nAChRs, modulates alpha-7-containing nAChRs, and inhibits nicotine-induced signaling probably implicating alpha-3:beta-4-containing nAChRs. Proposed to act on alpha-3:beta-2 and alpha-7 nAChRs in an orthosteric, and on mAChRs, such as CHRM1 and CHRM3, in an allosteric manner. {ECO:0000269|PubMed:16575903, ECO:0000269|PubMed:27485575}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed at highest levels in cervix and esophagus, followed by adult and fetal skin. Expressed at lower levels in brain, lung, stomach, small intestine, colon, rectum, uterus, and thymus. Not detected in spleen nor bone marrow. Up-regulated 3-fold in psoriatic lesional skin (PubMed:12573258). In the epidermis, predominantly produced by keratinocytes of the suprabasal epidermal compartment (at protein level) (PubMed:16575903). In attached gingiva, produced at highest levels by basal cells located in the lowermost epithelial layers (at protein level) (PubMed:16575903). Detected in serum (at protein level) (PubMed:16575903). {ECO:0000269|PubMed:12573258, ECO:0000269|PubMed:16575903}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |