Recombinant Human SIN3-HDAC complex-associated factor(SINHCAF) (Active)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% as determined by SDS-PAGE.
Uniprot ID Q9NP50
Uniprot Entry Name
Gene Names SINHCAF
Alternative Names Protein FAM60A (Tera protein homolog) (C12orf14) (FAM60A)
Expression Region Full Length (1-221aa)
Molecular Weight 51.9 kDa
Endotoxin Not test.
Sequence MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
Product Form Liquid or Lyophilized powder (If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance Subunit of the Sin3 deacetylase complex, this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway . Core component of a SIN3A complex present in embryonic stem cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming.
Function
Involvement in disease
Subcellular Location
Protein Families
Tissue Specificity
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-CEPHUe08820715

Recombinant Human SIN3-HDAC complex-associated factor(SINHCAF) (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SIN3-HDAC complex-associated factor(SINHCAF) (Active)
Copyright © 2026-present Echo Bio. All rights reserved.