Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P25063 |
| Gene Names | CD24 |
| Alternative Names | Small cell lung carcinoma cluster 4 antigen; CD24 |
| Expression Region | Full Length of Mature Protein(27-80aa ) |
| Molecular Weight | 32.3 kDa |
| Protein Sequence | SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. |
| Involvement in Disease | Multiple sclerosis (MS) |
| Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor |
| Protein Families | CD24 family |
| Tissue Specificity | CD24 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
