Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens surfactant associated 2 (SFTA2) (NM_205854). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q6UW10 |
| Entry Name | SFTA2_HUMAN |
| Gene Names | SFTA2 SFTPG UNQ541/PRO1098 |
| Alternative Gene Names | SFTPG |
| Alternative Protein Names | Surfactant-associated protein 2 (Surfactant-associated protein G) (SP-G) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 78 |
| Molecular Weight(Da) | 8396 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MGSGLPLVLLLTLLGSSHGTGPGMTLQLKLKESFLTNSSYESSFLELLEKLCLLLHLPSGTSVTLHHARSQHHVVCNT |
Background
| Function | FUNCTION: Putative surfactant protein. {ECO:0000305}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Predominantly expressed in lung, where it is detected in type II pneumocytes in the alveolus, and in nonciliated epithelium in bronchioli (at protein level). Also detected at lower levels in cervix, esophagus, stomach, testis and kidney. {ECO:0000269|PubMed:22768197}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |