Recombinant Human SFTA2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens surfactant associated 2 (SFTA2) (NM_205854).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q6UW10
Entry Name SFTA2_HUMAN
Gene Names SFTA2 SFTPG UNQ541/PRO1098
Alternative Gene Names SFTPG
Alternative Protein Names Surfactant-associated protein 2 (Surfactant-associated protein G) (SP-G)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 78
Molecular Weight(Da) 8396
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGSGLPLVLLLTLLGSSHGTGPGMTLQLKLKESFLTNSSYESSFLELLEKLCLLLHLPSGTSVTLHHARSQHHVVCNT
Background
Function FUNCTION: Putative surfactant protein. {ECO:0000305}.
Pathway
Protein Families
Tissue Specificity Predominantly expressed in lung, where it is detected in type II pneumocytes in the alveolus, and in nonciliated epithelium in bronchioli (at protein level). Also detected at lower levels in cervix, esophagus, stomach, testis and kidney. {ECO:0000269|PubMed:22768197}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8506355

Recombinant Human SFTA2 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SFTA2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.