Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P49591 |
| Gene Names | SERS |
| Alternative Names | Seryl-tRNA synthetase ;SerRSSeryl-tRNA(Ser/Sec) synthetase |
| Expression Region | Partial(2-233aa ) |
| Molecular Weight | 53.4 kDa |
| Protein Sequence | VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec). |
| Involvement in Disease | Neurodevelopmental disorder with microcephaly, ataxia, and seizures (NEDMAS) |
| Subcellular Location | Cytoplasm, Nucleus |
| Protein Families | Class-II aminoacyl-tRNA synthetase family, Type-1 seryl-tRNA synthetase subfamily |
| Tissue Specificity | SERS |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |