Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q86WD7 |
| Gene Names | SERPINA9 |
| Alternative Names | Centerin (Germinal center B-cell-expressed transcript 1 protein) (GCET1) (SERPINA11) |
| Expression Region | Full Length of Mature Protein(24-417aa ) |
| Molecular Weight | 49.1 kDa |
| Protein Sequence | ANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Protease inhibitor that inhibits trypsin and trypsin-like serine proteases. Inhibits plasmin and thrombin with lower efficiency |
| Involvement in Disease | |
| Subcellular Location | Isoform 1: Secreted, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm, SUBCELLULAR LOCATION: Isoform 5: Cytoplasm, SUBCELLULAR LOCATION: Isoform 6: Cytoplasm, SUBCELLULAR LOCATION: Isoform 7: Membrane, Single-pass type II membrane protein |
| Protein Families | Serpin family |
| Tissue Specificity | SERPINA9 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |