Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens stress-associated endoplasmic reticulum protein family member 2 (SERP2) (NM_001010897). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8N6R1 |
| Entry Name | SERP2_HUMAN |
| Gene Names | SERP2 C13orf21 |
| Alternative Gene Names | C13orf21 |
| Alternative Protein Names | Stress-associated endoplasmic reticulum protein 2 (Ribosome-associated membrane protein RAMP4-2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 65 |
| Molecular Weight(Da) | 7431 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGM |
Background
| Function | FUNCTION: May interact with target proteins during translocation into the lumen of the endoplasmic reticulum. May protect unfolded target proteins against degradation and facilitate correct glycosylation (Potential). {ECO:0000305}. |
| Pathway | |
| Protein Families | RAMP4 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |