Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta(PPP2R3B)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9Y5P8
Gene Names PPP2R3B
Alternative Names PP2A subunit B isoform PR48Protein phosphatase 2A 48KDA regulatory subunit
Expression Region Full Length of Isoform 2(1-176aa )
Molecular Weight 36.1 kDa
Protein Sequence MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Involvement in Disease
Subcellular Location Nucleus
Protein Families
Tissue Specificity PPP2R3B
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE3HU896658

Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta(PPP2R3B)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta(PPP2R3B)
Copyright © 2021-present Echo Biosystems. All rights reserved.