Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Protein Tag | N-terminal 6xHis-tagged |
Purity | Greater than 85% as determined by SDS-PAGE. |
Endotoxin Level | Not test. |
Biological Activity | |
Uniprot ID | Q9Y2H1 |
Gene Names | STK38L |
Alternative Names | (NDR2 protein kinase)(Nuclear Dbf2-related kinase 2) |
Expression Region | 212-464aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.51 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-143℃. |
Protein Length | Partial |
Molecular Weight | 33.5 kDa |
Protein Sequence | RDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL |
Background
Research Areas | Signal Transduction |
Relevance | Involved in the regulation of structural processes in differentiating and mature neuronal cells. |
Function | |
Reference | "Regulation of NDR2 protein kinase by multi-site phosphorylation and the S100B calcium-binding protein." Stegert M.R., Tamaskovic R., Bichsel S.J., Hergovich A., Hemmings B.A. J. Biol. Chem. 279:23806-23812(2004) |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |