Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O75494 |
| Gene Names | SRSF10 |
| Alternative Names | 40KDA SR-repressor protein ;SRrp40FUS-interacting serine-arginine-rich protein 1Splicing factor SRp38Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats ;TASR ;TLS-associated protein with SR repeatsTLS-associated serine-arginine protein ;TLS-associated SR protein |
| Expression Region | Full Length of Isoform 3(1-183aa ) |
| Molecular Weight | 38.2 kDa |
| Protein Sequence | MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Ses to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator. |
| Involvement in Disease | |
| Subcellular Location | Nucleus speckle, Cytoplasm |
| Protein Families | Splicing factor SR family |
| Tissue Specificity | SRSF10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |